PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa012846
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family G2-like
Protein Properties Length: 335aa    MW: 38127.8 Da    PI: 7.2662
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58685490PU_refUnigeneView CDS
PUT-187a-Lactuca_sativa-41949PU_unrefplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like98.35.4e-3168121255
    G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                +rlrWtp+LH  Fv+ave+LGG+e+AtPk +l+lm+++gL+++hvkSHLQ+YR+
  Lsa012846  68 ARLRWTPDLHLTFVKAVERLGGQERATPKLVLQLMNIQGLSIAHVKSHLQMYRS 121
                69***************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.07664124IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.1E-2964122IPR009057Homeodomain-like
SuperFamilySSF466895.55E-1467122IPR009057Homeodomain-like
TIGRFAMsTIGR015572.4E-2268123IPR006447Myb domain, plants
PfamPF002491.9E-969120IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MIEKADSNGS KMNNHLSCRN IIGEDEVDDE NNTKSSQSSG NNSMVDQVEG EKKDESIRVR  60
PYVRSKMARL RWTPDLHLTF VKAVERLGGQ ERATPKLVLQ LMNIQGLSIA HVKSHLQMYR  120
SKKIDDQDQV INRGDYYAGS NSHLLHNLCQ LPGLDQRLFK VNLSQNSWSN HVISRPSTNN  180
MINARIEDHG LNHGRQGDFN MNTIMNYGAY YMRKKPSNED ENCKIACQEV EKDETLTNTR  240
SSLIDPEFMN SFVNTKKRKA PLDEGLDLNL SLSLKGSMTR DDDEVDSALC LSLLSSSSKK  300
EKYYKDYGME SSRNLLEEGQ LRKNPRMSST LDLTI
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A103Y6Z62e-88A0A103Y6Z6_CYNCS; Homeodomain-like protein